PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0060s0039.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family GATA
Protein Properties Length: 331aa    MW: 35401.7 Da    PI: 6.6164
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0060s0039.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.15.7e-19249283135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  Kaladp0060s0039.1.p 249 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRL 283
                          *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169925.3E-784323IPR016679Transcription factor, GATA, plant
SMARTSM004012.0E-16243297IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.662243279IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.66E-14244305No hitNo description
Gene3DG3DSA:3.30.50.101.1E-14247281IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.21E-14248296No hitNo description
PfamPF003208.0E-17249283IPR000679Zinc finger, GATA-type
PROSITE patternPS003440249274IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MECVESALKG SFRKEMTLKL NHQAVIDDLP AAGLTTLTAD DFFVDDLLDF SEINAPDEED  60
NEVVVVADEK DETAKTCPGG LAGGEFGKEK AEACRNLVFK EGELSVPADD VADLEWLSHF  120
VDDSFPGYSL TCPAAPLPAK SCAQPPPPAP PVEASVKPTR ARSKRARNGV LGWSVSGSET  180
SSSTSSSSST SFSSSTTWLI YTNQPSHVDA VLESSAKQAT PRLTSAVKKR KTRPPREAAG  240
GPSAQPRRCS HCGVQKTPQW RAGPLGAKTL CNACGVRFKS GRLLPEYRPA CSPTFSSELH  300
SNHHRKVLEM RYKKELELPD AGSAPAVPSF *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002272762.13e-84PREDICTED: GATA transcription factor 5
TrEMBLF6GWQ63e-84F6GWQ6_VITVI; Putative uncharacterized protein
STRINGVIT_04s0023g02880.t019e-84(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.27e-54GATA transcription factor 5